DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and R06C1.4

DIOPT Version :10

Sequence 1:NP_477205.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_493029.1 Gene:R06C1.4 / 173076 WormBaseID:WBGene00011059 Length:84 Species:Caenorhabditis elegans


Alignment Length:74 Identity:16/74 - (21%)
Similarity:42/74 - (56%) Gaps:0/74 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 TLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMHAAYKHADGKK 167
            ::::..:.|..:|.::...|...|.:..:.:::|:|:|:|:|:||:|:..|.....|.:..:|..
 Worm     7 SVYVGNVPYQGTEEEIGNYFAAVGHVNNVRIVYDRETGRPRGFAFVEFSEEAGAQRAVEQLNGVA 71

  Fly   168 IDSKRVLVD 176
            .:.:.:.|:
 Worm    72 FNGRNLRVN 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_477205.1 U1snRNP70_N 3..92 CDD:432406
RRM_snRNP70 101..188 CDD:409682 16/74 (22%)
R06C1.4NP_493029.1 RRM_SF 7..82 CDD:473069 16/74 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.