DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and SC35

DIOPT Version :10

Sequence 1:NP_477205.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:XP_061513963.1 Gene:SC35 / 1279150 VectorBaseID:AGAMI1_006283 Length:167 Species:Anopheles gambiae


Alignment Length:205 Identity:52/205 - (25%)
Similarity:79/205 - (38%) Gaps:53/205 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 DPFRTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMHAAYKHA 163
            |...:|.:..:.|.|:...|||.||..|.:..|.:..|:.:.:.:|:||:.:..:||...|....
Mosquito    12 DGMISLKVDNLTYRTTPDDLRRVFERCGEVGDIYIPRDRHTRESRGFAFVRFYDKRDAEDALDAM 76

  Fly   164 DGKKIDSKRVLVDVERARTVKGWLPRRLGGGLGGTRRGGNDVNIKHSGREDNERERERYRLERER 228
            ||:.:|.:.  :.|:.||..:...|:|.|....|..||               |.|||:      
Mosquito    77 DGRMLDGRE--LRVQMARYGRPTSPQRRGNRYNGRERG---------------RSRERH------ 118

  Fly   229 EDREGPGRGGGSNGLDARPGRGFGAERRRSRSR----ERRDRERDRGRGAVASNGRSRSRSRERR 289
                                      |||||||    .||...|.:.|...:.:|...||.::.|
Mosquito   119 --------------------------RRRSRSRSPEHRRRSYSRSKSRTPRSRSGSKSSRGKDSR 157

  Fly   290 KRRAGSRERY 299
            .|....|..|
Mosquito   158 SRSPAERGHY 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_477205.1 U1snRNP70_N 3..92 CDD:432406
RRM_snRNP70 101..188 CDD:409682 23/86 (27%)
SC35XP_061513963.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.