DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and Srsf1

DIOPT Version :10

Sequence 1:NP_477205.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_775550.2 Gene:Srsf1 / 110809 MGIID:98283 Length:248 Species:Mus musculus


Alignment Length:303 Identity:66/303 - (21%)
Similarity:86/303 - (28%) Gaps:136/303 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 LFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMHAAYKHADGKKI 168
            :::..:..|.....:...|..||.|:.|.| .::..|.|  :||:|:|..||...|....||...
Mouse    18 IYVGNLPPDIRTKDIEDVFYKYGAIRDIDL-KNRRGGPP--FAFVEFEDPRDAEDAVYGRDGYDY 79

  Fly   169 DSKRVLVDVERARTVKGWLPRRLGGGLGGTRRGGNDVNIKHSGREDNERERERYRLEREREDREG 233
            |..|:.|:..|                              |||                    |
Mouse    80 DGYRLRVEFPR------------------------------SGR--------------------G 94

  Fly   234 PGRGGGSNGLDARPGRGFGAERRRSRSR-------------ERRDRERDRG-------------- 271
            .|||||..|....|...:|...|||.:|             :.:|..|:.|              
Mouse    95 TGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGV 159

  Fly   272 ------------------------RGAVA------------SNGRSRSRSRERRKRRAGSRERYD 300
                                    .|..|            |.||||||||.             
Mouse   160 VEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRS------------- 211

  Fly   301 EFDRRDRRDRERERDRDREREKKKKRSKSRERESSRERRERKR 343
                   |.|.|.|...|.|....:||:...|.|.|..|.|.|
Mouse   212 -------RSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSR 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_477205.1 U1snRNP70_N 3..92 CDD:432406
RRM_snRNP70 101..188 CDD:409682 22/83 (27%)
Srsf1NP_775550.2 RRM1_SRSF1 12..90 CDD:410010 21/74 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..134 17/95 (18%)
RRM2_SRSF1 113..196 CDD:410160 10/82 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..248 23/77 (30%)
Interaction with SAFB1. /evidence=ECO:0000250 198..247 22/68 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.