DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and cstf2

DIOPT Version :9

Sequence 1:NP_001260173.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:XP_012823534.1 Gene:cstf2 / 100170457 XenbaseID:XB-GENE-979047 Length:522 Species:Xenopus tropicalis


Alignment Length:106 Identity:33/106 - (31%)
Similarity:58/106 - (54%) Gaps:6/106 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 DPTEIKNATEDPFRTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHE 153
            ||     |.:...|::|:..|.|:.:|.:|:..|...||:....|::|:|:||||||.|.||:.:
 Frog     8 DP-----AVDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQ 67

  Fly   154 RDMHAAYKHADGKKIDSKRVLVDVERARTVKGWLPRRLGGG 194
            ....:|.::.:|::...:.:.||...:...|..| :.||.|
 Frog    68 ETALSAMRNLNGREFSGRALRVDNAASEKNKEEL-KSLGTG 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_001260173.1 U1snRNP70_N 2..92 CDD:289024 2/2 (100%)
RRM <97..>179 CDD:223796 25/81 (31%)
RRM_snRNP70 101..188 CDD:240682 26/86 (30%)
cstf2XP_012823534.1 half-pint 18..>330 CDD:130706 29/91 (32%)
RRM_CSTF2_CSTF2T 18..92 CDD:241115 24/73 (33%)
CSTF2_hinge 112..191 CDD:373015
PHA03247 <207..478 CDD:223021
CSTF_C 478..518 CDD:373006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1455080at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.