DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-70K and srsf4

DIOPT Version :9

Sequence 1:NP_001260173.1 Gene:snRNP-U1-70K / 33982 FlyBaseID:FBgn0016978 Length:448 Species:Drosophila melanogaster
Sequence 2:XP_004911639.2 Gene:srsf4 / 100038227 XenbaseID:XB-GENE-493077 Length:741 Species:Xenopus tropicalis


Alignment Length:286 Identity:85/286 - (29%)
Similarity:127/286 - (44%) Gaps:58/286 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 LFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMHAAYKHADGKKI 168
            ::|.|:::...|..:.|.|:.:|.|.::.|        ..||.|:|:|..||...|....:|:::
 Frog     9 VYIGRLSHRARERDVERFFKGFGKIVEVDL--------KNGYGFVEFEDSRDAEDAVYEMNGREL 65

  Fly   169 DSKRVLVDVERARTVKGWLPRR-LGGGLGGTRRGGNDVNIKHSGREDNERERERYRLERE----- 227
            ..:||:|:..||       ||| :..|. |.|:||:|        :.....|..|||..|     
 Frog    66 CGERVIVEHARA-------PRRDIRSGY-GYRKGGSD--------KYGPPVRTMYRLRVENLSSR 114

  Fly   228 ---REDREGPGRGGGSNGLDARPGR-GFGAERRRSRSRERR-------------------DRERD 269
               ::.::...:.|.....||...| ..|....||.|..||                   ||...
 Frog   115 CSWQDLKDFMRQAGEVTYADAHQRRQNEGVIEFRSYSDMRRALEKLDGSEINGRKIQLVEDRAGS 179

  Fly   270 RGRGAVASNGRSRSRSRERRKRRAGSRERYDEFDRRDRRDRERERDRDREREKKKKRSKSRERES 334
            |.:|   |:.|||||||.||.|.:.||.|  ...|...|.|:|||.|.|.:|::..||.||:|..
 Frog   180 RNKG---SSSRSRSRSRSRRSRSSHSRSR--SRSRSHSRSRQRERSRSRSKERRSSRSHSRKRRE 239

  Fly   335 SRERRERKRERRDRERGTGSGGDVKE 360
            ||...:|:|:.|...:|..:...|.:
 Frog   240 SRSISKRRRQSRSVSKGRRASRSVSK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-70KNP_001260173.1 U1snRNP70_N 2..92 CDD:289024
RRM <97..>179 CDD:223796 20/74 (27%)
RRM_snRNP70 101..188 CDD:240682 22/83 (27%)
srsf4XP_004911639.2 RRM_SF 6..77 CDD:418427 20/75 (27%)
RRM_SF 104..176 CDD:418427 14/71 (20%)
ser_rich_anae_1 <249..>456 CDD:411418 3/17 (18%)
PRK12678 352..>573 CDD:237171
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.