DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sumo and ESC2

DIOPT Version :10

Sequence 1:NP_477411.1 Gene:Sumo / 33981 FlyBaseID:FBgn0264922 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_010650.1 Gene:ESC2 / 851965 SGDID:S000002771 Length:456 Species:Saccharomyces cerevisiae


Alignment Length:72 Identity:18/72 - (25%)
Similarity:37/72 - (51%) Gaps:1/72 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSMQV-VRFRFDGQPINENDTPTSLEME 74
            |.:.:.::||||..:...:::.||..|:...|..:..|..:. |:..||...::.|:.....:||
Yeast   382 EVMRIALMGQDNKKIYVHVRRSTPFSKIAEYYRIQKQLPQKTRVKLLFDHDELDMNECIADQDME 446

  Fly    75 EGDTIEV 81
            :.|.::|
Yeast   447 DEDMVDV 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SumoNP_477411.1 Ubl_SUMO2_3_4 12..83 CDD:340532 17/71 (24%)
ESC2NP_010650.1 ATP-synt_Fo_b <265..357 CDD:473877
Ubl_SLD2_Esc2_like 382..454 CDD:340600 18/72 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.