DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sumo and NFATC2IP

DIOPT Version :10

Sequence 1:NP_477411.1 Gene:Sumo / 33981 FlyBaseID:FBgn0264922 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_116204.3 Gene:NFATC2IP / 84901 HGNCID:25906 Length:419 Species:Homo sapiens


Alignment Length:85 Identity:21/85 - (24%)
Similarity:30/85 - (35%) Gaps:25/85 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 HGGLSYEALMDMPYIDQCINESLRKYPPGANLIRQVSQDYRVPGTDVTFPKGMNVMIPVYAIHHD 394
            :||..|:|.....|     |.|.:.|.|.|.|           |||     |:....|..::...
Human    13 YGGYPYQAANGFAY-----NASQQPYAPSAAL-----------GTD-----GVEYHRPACSLQSP 56

  Fly   395 ADNYPDPERYDPDRFAPEAC 414
            |.....|:.::    ..|||
Human    57 ASAGGHPKTHE----LSEAC 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SumoNP_477411.1 Ubl_SUMO2_3_4 12..83 CDD:340532
NFATC2IPNP_116204.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..131 21/85 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..215
Ubl_SLD1_NFATC2ip 263..336 CDD:340598
Ubl_SLD2_NFATC2ip 346..418 CDD:340599
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.