DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sumo and AT1G68185

DIOPT Version :10

Sequence 1:NP_477411.1 Gene:Sumo / 33981 FlyBaseID:FBgn0264922 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001322066.1 Gene:AT1G68185 / 843147 AraportID:AT1G68185 Length:261 Species:Arabidopsis thaliana


Alignment Length:83 Identity:25/83 - (30%)
Similarity:41/83 - (49%) Gaps:16/83 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EKKGGETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSMQVVRFRFDGQPINENDTP 68
            :|.|.:|    |:|...:.            ..:::..|.|:|.|..|.:.|.|||..|:.:.||
plant   195 DKDGQKT----LRVFADEK------------FERVIKLYTDKAKLDPQNLVFIFDGDKIDPSTTP 243

  Fly    69 TSLEMEEGDTIEVYQQQT 86
            :.|.||:.|.|||:.::|
plant   244 SELGMEDHDMIEVHTKKT 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SumoNP_477411.1 Ubl_SUMO2_3_4 12..83 CDD:340532 21/70 (30%)
AT1G68185NP_001322066.1 Ubl_SUMO_like 188..257 CDD:340462 23/77 (30%)

Return to query results.
Submit another query.