DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sumo and SUMO1

DIOPT Version :10

Sequence 1:NP_477411.1 Gene:Sumo / 33981 FlyBaseID:FBgn0264922 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_194414.1 Gene:SUMO1 / 828791 AraportID:AT4G26840 Length:100 Species:Arabidopsis thaliana


Alignment Length:87 Identity:44/87 - (50%)
Similarity:56/87 - (64%) Gaps:0/87 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DEKKGGETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSMQVVRFRFDGQPINENDT 67
            |:|.|....||||||.|||...|.|:||:.|.|:|||||||||..:.|..:.|.|||:.:....|
plant     8 DKKPGDGGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDMNSIAFLFDGRRLRAEQT 72

  Fly    68 PTSLEMEEGDTIEVYQQQTGGA 89
            |..|:||:||.|:....||||:
plant    73 PDELDMEDGDEIDAMLHQTGGS 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SumoNP_477411.1 Ubl_SUMO2_3_4 12..83 CDD:340532 37/70 (53%)
SUMO1NP_194414.1 Ubl_Smt3_like 16..89 CDD:340533 37/72 (51%)

Return to query results.
Submit another query.