DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sumo and nfatc2ip

DIOPT Version :10

Sequence 1:NP_477411.1 Gene:Sumo / 33981 FlyBaseID:FBgn0264922 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001072535.1 Gene:nfatc2ip / 779990 XenbaseID:XB-GENE-6457267 Length:434 Species:Xenopus tropicalis


Alignment Length:74 Identity:25/74 - (33%)
Similarity:40/74 - (54%) Gaps:2/74 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EHINLKVLGQD-NAVVQFKIKKHTPLRKLMNAYCDRAGLSMQ-VVRFRFDGQPINENDTPTSLEM 73
            |.|.:||.|:: .:.:...:.|..||:.||:.|....||:.: .|.|.|:||.:...:|...|.:
 Frog   360 EKICIKVQGKEKQSHLSVMVGKVEPLQSLMDQYQAAMGLTKKHKVSFFFEGQKLKGKNTAEELGL 424

  Fly    74 EEGDTIEVY 82
            |..|.|||:
 Frog   425 ESDDIIEVW 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SumoNP_477411.1 Ubl_SUMO2_3_4 12..83 CDD:340532 24/73 (33%)
nfatc2ipNP_001072535.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63
PHA03247 <26..213 CDD:223021
SPRR2 <26..63 CDD:434240
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..237
Ubl_SLD1_NFATC2ip 275..348 CDD:340598
Ubl_SLD2_NFATC2ip 360..433 CDD:340599 24/72 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.