DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smt3 and SUMO1

DIOPT Version :9

Sequence 1:NP_001303312.1 Gene:smt3 / 33981 FlyBaseID:FBgn0264922 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001358323.1 Gene:SUMO1 / 7341 HGNCID:12502 Length:146 Species:Homo sapiens


Alignment Length:133 Identity:46/133 - (34%)
Similarity:63/133 - (47%) Gaps:48/133 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDEKKGGETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSMQVVRFRFDGQPINEN 65
            :.|:|:|   |:|.|||:|||::.:.||:|..|.|:||..:||.|.|:.|..:||.|:||.|.:|
Human    13 LGDKKEG---EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADN 74

  Fly    66 DTP---------------------------------------------TSLEMEEGDTIEVYQQQ 85
            .||                                             :.|.|||.|.|||||:|
Human    75 HTPKEAQWPTPAILALWEAEAGWITAGQELRPAWATWRNLISTKNRKSSQLGMEEEDVIEVYQEQ 139

  Fly    86 TGG 88
            |||
Human   140 TGG 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smt3NP_001303312.1 Ubl_SUMO2_3_4 12..83 CDD:340532 36/115 (31%)
SUMO1NP_001358323.1 Ubl_SUMO1 21..141 CDD:340531 39/119 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5227
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S485
OMA 1 1.010 - - QHG54171
OrthoDB 1 1.010 - - D1583700at2759
OrthoFinder 1 1.000 - - FOG0000413
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100654
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2296
SonicParanoid 1 1.000 - - X327
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.