DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smt3 and AT5G55856

DIOPT Version :9

Sequence 1:NP_001303312.1 Gene:smt3 / 33981 FlyBaseID:FBgn0264922 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001119444.1 Gene:AT5G55856 / 6241016 AraportID:AT5G55856 Length:97 Species:Arabidopsis thaliana


Alignment Length:87 Identity:39/87 - (44%)
Similarity:54/87 - (62%) Gaps:0/87 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDEKKGGETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSMQVVRFRFDGQPINEND 66
            ||:|....:.||.:||..||:..|.|:||:...|||:|:||.|:.|:.|..:||.|||..|..|.
plant     4 SDKKPLIPSSHITVKVKNQDDICVYFRIKRDVELRKMMHAYSDKVGVEMSTLRFLFDGNRIKLNQ 68

  Fly    67 TPTSLEMEEGDTIEVYQQQTGG 88
            ||..|.:|:.|.||.:.:|.||
plant    69 TPNELGLEDEDEIEAFGEQLGG 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smt3NP_001303312.1 Ubl_SUMO2_3_4 12..83 CDD:340532 33/70 (47%)
AT5G55856NP_001119444.1 UBQ 11..90 CDD:294102 34/78 (44%)
UBQ 15..82 CDD:214563 30/66 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3084
eggNOG 1 0.900 - - E1_COG5227
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54171
OrthoDB 1 1.010 - - D1583700at2759
OrthoFinder 1 1.000 - - FOG0000413
OrthoInspector 1 1.000 - - otm2521
orthoMCL 1 0.900 - - OOG6_100654
Panther 1 1.100 - - O PTHR10562
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X327
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.790

Return to query results.
Submit another query.