DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smt3 and sumo2

DIOPT Version :9

Sequence 1:NP_001303312.1 Gene:smt3 / 33981 FlyBaseID:FBgn0264922 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001016406.1 Gene:sumo2 / 549160 XenbaseID:XB-GENE-969139 Length:95 Species:Xenopus tropicalis


Alignment Length:94 Identity:65/94 - (69%)
Similarity:78/94 - (82%) Gaps:5/94 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDE--KKGGETE---HINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSMQVVRFRFDGQ 60
            |:|:  |:|.:||   ||||||.|||.:|||||||:||||.|||.|||:|.||||:.:|||||||
 Frog     1 MADDKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLNKLMKAYCERQGLSMRQIRFRFDGQ 65

  Fly    61 PINENDTPTSLEMEEGDTIEVYQQQTGGA 89
            ||||.|||..||||:.|||:|:||||||:
 Frog    66 PINETDTPAQLEMEDEDTIDVFQQQTGGS 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smt3NP_001303312.1 Ubl_SUMO2_3_4 12..83 CDD:340532 53/70 (76%)
sumo2NP_001016406.1 Ubl_SUMO2_3_4 17..88 CDD:340532 53/70 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 113 1.000 Domainoid score I6069
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I4461
OMA 1 1.010 - - QHG54171
OrthoDB 1 1.010 - - D1583700at2759
OrthoFinder 1 1.000 - - FOG0000413
OrthoInspector 1 1.000 - - otm49531
Panther 1 1.100 - - LDO PTHR10562
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X327
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.