DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smt3 and sumo1

DIOPT Version :9

Sequence 1:NP_001303312.1 Gene:smt3 / 33981 FlyBaseID:FBgn0264922 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001005111.1 Gene:sumo1 / 448691 XenbaseID:XB-GENE-978491 Length:102 Species:Xenopus tropicalis


Alignment Length:88 Identity:45/88 - (51%)
Similarity:64/88 - (72%) Gaps:2/88 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDEKKGGETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSMQVVRFRFDGQPINEN 65
            :.|:|:||  ::|.|||:|||::.:.||:|..|.|:||..:||.|.|:.|..:||.|:||.|:::
 Frog    13 LGDKKEGG--DYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRISDH 75

  Fly    66 DTPTSLEMEEGDTIEVYQQQTGG 88
            .||..|.|||.|.|||||:||||
 Frog    76 QTPKELGMEEEDVIEVYQEQTGG 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smt3NP_001303312.1 Ubl_SUMO2_3_4 12..83 CDD:340532 35/70 (50%)
sumo1NP_001005111.1 Sumo 14..98 CDD:176359 43/85 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54171
OrthoDB 1 1.010 - - D1583700at2759
OrthoFinder 1 1.000 - - FOG0000413
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2296
SonicParanoid 1 1.000 - - X327
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.