DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smt3 and sumo1

DIOPT Version :9

Sequence 1:NP_001303312.1 Gene:smt3 / 33981 FlyBaseID:FBgn0264922 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_998324.1 Gene:sumo1 / 406438 ZFINID:ZDB-GENE-040426-2186 Length:100 Species:Danio rerio


Alignment Length:98 Identity:48/98 - (48%)
Similarity:62/98 - (63%) Gaps:12/98 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSD----------EKKGGETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSMQVVRF 55
            |||          |||.|  |:|.|||:||||:.:.||:|..|.|:||..:|..|.|:.:..:||
Zfish     1 MSDTETKPSSDGGEKKDG--EYIKLKVIGQDNSEIHFKVKMTTHLKKLKESYSQRQGVPVNSLRF 63

  Fly    56 RFDGQPINENDTPTSLEMEEGDTIEVYQQQTGG 88
            .|:||.|.:|.||..|.||:.|.|||||:||||
Zfish    64 LFEGQRITDNLTPKELGMEDEDVIEVYQEQTGG 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smt3NP_001303312.1 Ubl_SUMO2_3_4 12..83 CDD:340532 34/70 (49%)
sumo1NP_998324.1 Sumo 10..96 CDD:176359 43/87 (49%)
UBQ 21..92 CDD:214563 35/70 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5227
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54171
OrthoDB 1 1.010 - - D1583700at2759
OrthoFinder 1 1.000 - - FOG0000413
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100654
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2296
SonicParanoid 1 1.000 - - X327
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.