DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smt3 and sumo3a

DIOPT Version :9

Sequence 1:NP_001303312.1 Gene:smt3 / 33981 FlyBaseID:FBgn0264922 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_998289.1 Gene:sumo3a / 406398 ZFINID:ZDB-GENE-040426-2133 Length:94 Species:Danio rerio


Alignment Length:93 Identity:64/93 - (68%)
Similarity:77/93 - (82%) Gaps:4/93 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDEK-KGG---ETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSMQVVRFRFDGQP 61
            ||::| |.|   |.:||||||.|||.:|||||||:||||.|||.|||:|.|||::.:||||||||
Zfish     1 MSEDKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSIRQIRFRFDGQP 65

  Fly    62 INENDTPTSLEMEEGDTIEVYQQQTGGA 89
            |||.|||..||||:.|||:|:||||||:
Zfish    66 INETDTPAQLEMEDEDTIDVFQQQTGGS 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smt3NP_001303312.1 Ubl_SUMO2_3_4 12..83 CDD:340532 52/70 (74%)
sumo3aNP_998289.1 Ubl_SUMO2_3_4 16..87 CDD:340532 52/70 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581254
Domainoid 1 1.000 111 1.000 Domainoid score I6183
eggNOG 1 0.900 - - E1_COG5227
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38251
Inparanoid 1 1.050 131 1.000 Inparanoid score I4606
OMA 1 1.010 - - QHG54171
OrthoDB 1 1.010 - - D1583700at2759
OrthoFinder 1 1.000 - - FOG0000413
OrthoInspector 1 1.000 - - otm25531
orthoMCL 1 0.900 - - OOG6_100654
Panther 1 1.100 - - O PTHR10562
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2296
SonicParanoid 1 1.000 - - X327
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.