DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sumo and Nfatc2ip

DIOPT Version :10

Sequence 1:NP_477411.1 Gene:Sumo / 33981 FlyBaseID:FBgn0264922 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001007693.1 Gene:Nfatc2ip / 308983 RGDID:1359096 Length:414 Species:Rattus norvegicus


Alignment Length:74 Identity:24/74 - (32%)
Similarity:45/74 - (60%) Gaps:1/74 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TEHINLKVLGQD-NAVVQFKIKKHTPLRKLMNAYCDRAGLSMQVVRFRFDGQPINENDTPTSLEM 73
            ::.:.|:|.|:: :.:::..:...:||:.||:.|.:..|||...:.|.|||..::..:.||.|.:
  Rat   340 SQELRLRVQGKEKHQMLEISLSPDSPLKVLMSHYEEAMGLSGHKLSFFFDGTKLSGKELPTDLGL 404

  Fly    74 EEGDTIEVY 82
            |.||.|||:
  Rat   405 ESGDLIEVW 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SumoNP_477411.1 Ubl_SUMO2_3_4 12..83 CDD:340532 24/72 (33%)
Nfatc2ipNP_001007693.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..118
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..208
Ubl_SLD1_NFATC2ip 258..330 CDD:340598
Ubl_SLD2_NFATC2ip 341..413 CDD:340599 23/71 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.