DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smt3 and smo-1

DIOPT Version :9

Sequence 1:NP_001303312.1 Gene:smt3 / 33981 FlyBaseID:FBgn0264922 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_490842.1 Gene:smo-1 / 266820 WormBaseID:WBGene00004888 Length:91 Species:Caenorhabditis elegans


Alignment Length:90 Identity:43/90 - (47%)
Similarity:64/90 - (71%) Gaps:2/90 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDE--KKGGETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSMQVVRFRFDGQPIN 63
            |:|:  :.|...|:|.:||:|||:..|.|::|..|.:.||..:|.||.|:::..:||.|||:.||
 Worm     1 MADDAAQAGDNAEYIKIKVVGQDSNEVHFRVKYGTSMAKLKKSYADRTGVAVNSLRFLFDGRRIN 65

  Fly    64 ENDTPTSLEMEEGDTIEVYQQQTGG 88
            ::|||.:||||:.|.|||||:|.||
 Worm    66 DDDTPKTLEMEDDDVIEVYQEQLGG 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smt3NP_001303312.1 Ubl_SUMO2_3_4 12..83 CDD:340532 34/70 (49%)
smo-1NP_490842.1 Sumo 4..90 CDD:176359 39/85 (46%)
UBQ 15..86 CDD:214563 35/70 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I5784
eggNOG 1 0.900 - - E1_COG5227
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I3672
Isobase 1 0.950 - 0 Normalized mean entropy S485
OMA 1 1.010 - - QHG54171
OrthoDB 1 1.010 - - D1583700at2759
OrthoFinder 1 1.000 - - FOG0000413
OrthoInspector 1 1.000 - - oto18559
orthoMCL 1 0.900 - - OOG6_100654
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2296
SonicParanoid 1 1.000 - - X327
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.720

Return to query results.
Submit another query.