DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smt3 and pmt3

DIOPT Version :9

Sequence 1:NP_001303312.1 Gene:smt3 / 33981 FlyBaseID:FBgn0264922 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001342889.1 Gene:pmt3 / 2540927 PomBaseID:SPBC365.06 Length:117 Species:Schizosaccharomyces pombe


Alignment Length:79 Identity:45/79 - (56%)
Similarity:52/79 - (65%) Gaps:0/79 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSMQVVRFRFDGQPINENDTPTSLEME 74
            ||||||||:||||..|.|||||.|...|||..||.|.|.||..:||..||:.|..:.||..|:||
pombe    33 TEHINLKVVGQDNNEVFFKIKKTTEFSKLMKIYCARQGKSMNSLRFLVDGERIRPDQTPAELDME 97

  Fly    75 EGDTIEVYQQQTGG 88
            :||.||...:|.||
pombe    98 DGDQIEAVLEQLGG 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smt3NP_001303312.1 Ubl_SUMO2_3_4 12..83 CDD:340532 40/70 (57%)
pmt3NP_001342889.1 SMT3 1..114 CDD:227552 45/79 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I2426
eggNOG 1 0.900 - - E1_COG5227
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I1764
OMA 1 1.010 - - QHG54171
OrthoFinder 1 1.000 - - FOG0000413
OrthoInspector 1 1.000 - - oto102162
orthoMCL 1 0.900 - - OOG6_100654
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2296
SonicParanoid 1 1.000 - - X327
TreeFam 1 0.960 - -
1110.760

Return to query results.
Submit another query.