DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sumo and Nfatc2ip

DIOPT Version :10

Sequence 1:NP_477411.1 Gene:Sumo / 33981 FlyBaseID:FBgn0264922 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_035030.2 Gene:Nfatc2ip / 18020 MGIID:1329015 Length:412 Species:Mus musculus


Alignment Length:84 Identity:25/84 - (29%)
Similarity:48/84 - (57%) Gaps:2/84 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDEKKGGET-EHINLKVLGQD-NAVVQFKIKKHTPLRKLMNAYCDRAGLSMQVVRFRFDGQPIN 63
            ::...:..|| :.:.|:|.|:: :.:::..:...:||:.||:.|.:..|||...:.|.|||..::
Mouse   328 LASSSEATETSQELRLRVQGKEKHQMLEISLSPDSPLKVLMSHYEEAMGLSGHKLSFFFDGTKLS 392

  Fly    64 ENDTPTSLEMEEGDTIEVY 82
            ..:.|..|.:|.||.|||:
Mouse   393 GKELPADLGLESGDLIEVW 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SumoNP_477411.1 Ubl_SUMO2_3_4 12..83 CDD:340532 23/72 (32%)
Nfatc2ipNP_035030.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..115
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..206
Ubl_SLD1_NFATC2ip 256..328 CDD:340598 25/84 (30%)
Ubl_SLD2_NFATC2ip 339..411 CDD:340599 22/71 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.