DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smt3 and sumo2a

DIOPT Version :9

Sequence 1:NP_001303312.1 Gene:smt3 / 33981 FlyBaseID:FBgn0264922 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001373345.1 Gene:sumo2a / 100334083 ZFINID:ZDB-GENE-120215-155 Length:94 Species:Danio rerio


Alignment Length:92 Identity:55/92 - (59%)
Similarity:66/92 - (71%) Gaps:4/92 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDEK-KGG---ETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSMQVVRFRFDGQP 61
            |:||| |.|   |..||||:|..||.:|||||||||.||.|||..||||.||:.:::||.|||:.
Zfish     1 MADEKTKDGVKSEKSHINLRVSSQDGSVVQFKIKKHAPLSKLMKVYCDRQGLTRKLIRFMFDGES 65

  Fly    62 INENDTPTSLEMEEGDTIEVYQQQTGG 88
            |.|.|||..||||:.|.|||:|:|..|
Zfish    66 IKETDTPALLEMEDEDAIEVFQEQLAG 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smt3NP_001303312.1 Ubl_SUMO2_3_4 12..83 CDD:340532 45/70 (64%)
sumo2aNP_001373345.1 Ubl_SUMO2_3_4 16..87 CDD:340532 45/70 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4606
OMA 1 1.010 - - QHG54171
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000413
OrthoInspector 1 1.000 - - otm25531
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10562
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X327
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.