DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmgcl and HMGCLL1

DIOPT Version :9

Sequence 1:NP_001285696.1 Gene:Hmgcl / 33978 FlyBaseID:FBgn0031877 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_061909.2 Gene:HMGCLL1 / 54511 HGNCID:21359 Length:370 Species:Homo sapiens


Alignment Length:289 Identity:179/289 - (61%)
Similarity:232/289 - (80%) Gaps:0/289 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VRIVEVGPRDGLQNEPKLLPAATKIELINQLSETGLRTIEATSFVSAKWVPQMGDNAEVLKGIRK 90
            |:|||||||||||||..::|...|||.||:||:|||..||.|||||::|||||.|:.||:|||.:
Human    78 VKIVEVGPRDGLQNEKVIVPTDIKIEFINRLSQTGLSVIEVTSFVSSRWVPQMADHTEVMKGIHQ 142

  Fly    91 VTGISYPVLTPNLKGFESALEAGAEEVAVFGAASDAFSLKNVNCTAAEAIERFKPVLKAAQKHGV 155
            ..|:.||||||||:||..|:.|||.|::||||||::||.||:||:..|::.:|:.|:|:|:...:
Human   143 YPGVRYPVLTPNLQGFHHAVAAGATEISVFGAASESFSKKNINCSIEESMGKFEEVVKSARHMNI 207

  Fly   156 RVRGYVSTVVGCPYEGAVAPSAVVKVVEALYQMGCYEISLGDTIGVGTPGTMRRMLDEVTKVVPA 220
            ..|||||..:||||||::.|..|.:|.:.||.||||||||||||||||||:|:|||:.|.|.:|.
Human   208 PARGYVSCALGCPYEGSITPQKVTEVSKRLYGMGCYEISLGDTIGVGTPGSMKRMLESVMKEIPP 272

  Fly   221 KDLAVHCHDTYGQALSNILVSLDYGIRVVDSSVSGLGGCPYAKGASGNAATEDVVYLLHGMGLDT 285
            ..|||||||||||||:|||.:|..||.||||:||||||||||||||||.||||::|:|:|:||:|
Human   273 GALAVHCHDTYGQALANILTALQMGINVVDSAVSGLGGCPYAKGASGNVATEDLIYMLNGLGLNT 337

  Fly   286 GVNLDKLIQVGRYICTELGRTSESKVNRA 314
            ||||.|:::.|.:||..:.:|:.|||.:|
Human   338 GVNLYKVMEAGDFICKAVNKTTNSKVAQA 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgclNP_001285696.1 HMGL-like 25..299 CDD:279072 172/272 (63%)
DRE_TIM_HMGL 28..300 CDD:163676 171/271 (63%)
HMGCLL1NP_061909.2 PLN02746 56..366 CDD:178347 178/287 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 373 1.000 Domainoid score I896
eggNOG 1 0.900 - - E1_COG0119
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 388 1.000 Inparanoid score I2024
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55007
OrthoDB 1 1.010 - - D1029775at2759
OrthoFinder 1 1.000 - - FOG0002283
OrthoInspector 1 1.000 - - otm40515
orthoMCL 1 0.900 - - OOG6_101527
Panther 1 1.100 - - O PTHR42738
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4186
SonicParanoid 1 1.000 - - X1709
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.