DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atac1 and ZUO1

DIOPT Version :9

Sequence 1:NP_609088.1 Gene:Atac1 / 33977 FlyBaseID:FBgn0031876 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_011801.1 Gene:ZUO1 / 853202 SGDID:S000003517 Length:433 Species:Saccharomyces cerevisiae


Alignment Length:264 Identity:50/264 - (18%)
Similarity:85/264 - (32%) Gaps:90/264 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 AQR-IRVH--QQIEELEATQNIYLENPQHMLDKLRNNEPLIADNYITTTVLPDLPTLSPNDEEGG 102
            ||| :|.|  .:.|.:||.:|:      ..:|: .|.:|   |..:..|.|.|...|:       
Yeast    40 AQRTLRNHTWSEFERIEAEKNV------KTVDE-SNVDP---DELLFDTELADEDLLT------- 87

  Fly   103 TNETPTDASSWTQEANKNRDRSNGRSENFNRLWTNEEQ--SRLEQLLIQYPPEEVEMRRFGKIAK 165
                 .||..|     |..|.......:..|....|.|  ....:.:::|.|:        |.:.
Yeast    88 -----HDARDW-----KTADLYAAMGLSKLRFRATESQIIKAHRKQVVKYHPD--------KQSA 134

  Fly   166 ALGNRTAQQVYSRVQKYFQKLHDAGMPVPGRIPKHRRPGLSKPKIKLRKSTFFPAHNISLQMPED 230
            |.|:......:..:||.|:.|.|:                                |...|....
Yeast   135 AGGSLDQDGFFKIIQKAFETLTDS--------------------------------NKRAQYDSC 167

  Fly   231 DFTFDDLRIPSPASDMLLMPASKIEPKIESEYMDA---DLNAESKRKQELCLKLLSAIQDEKREM 292
            ||..|   :|.|            :...:.::.:|   ...||::..::..:..|......|:|:
Yeast   168 DFVAD---VPPP------------KKGTDYDFYEAWGPVFEAEARFSKKTPIPSLGNKDSSKKEV 217

  Fly   293 EDGY 296
            |..|
Yeast   218 EQFY 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atac1NP_609088.1 SANT 135..185 CDD:197842 10/51 (20%)
SANT 135..183 CDD:238096 9/49 (18%)
ZUO1NP_011801.1 ZUO1 50..433 CDD:227594 45/254 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.