DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atac1 and LHY

DIOPT Version :10

Sequence 1:NP_609088.1 Gene:Atac1 / 33977 FlyBaseID:FBgn0031876 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_171614.1 Gene:LHY / 839341 AraportID:AT1G01060 Length:645 Species:Arabidopsis thaliana


Alignment Length:246 Identity:60/246 - (24%)
Similarity:92/246 - (37%) Gaps:85/246 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 KNRDRSNGRSENFNRLWTNEEQSRLEQLLIQYPPEEVEMRRFGKIAKALGNRTAQQVYSRVQKYF 183
            |.|:|           ||.:|..|..:.|..|.      |.:.:|.:.:|.:||.|:.|..||:|
plant    22 KQRER-----------WTEDEHERFLEALRLYG------RAWQRIEEHIGTKTAVQIRSHAQKFF 69

  Fly   184 QKLHD----AGMPV--------PGRIPKHRRPGLSKPKIKLRKSTFFPAHN--ISLQMPEDDFTF 234
            .||..    .|:||        |...|| |:|....|    ||    |.:|  .|.|:.    :.
plant    70 TKLEKEAEVKGIPVCQALDIEIPPPRPK-RKPNTPYP----RK----PGNNGTSSSQVS----SA 121

  Fly   235 DDLRIPSPAS---------DMLLMPASKIEPKIESEYMDADLNAESK-RKQELCLKLLS------ 283
            .|.::.|.||         |:..||.|: :.....|..|.:.:..|. .|..|..|.:|      
plant   122 KDAKLVSSASSSQLNQAFLDLEKMPFSE-KTSTGKENQDENCSGVSTVNKYPLPTKQVSGDIETS 185

  Fly   284 -------AIQD--EKREMEDG---------------YEPDLLAAKCAECEE 310
                   |:||  :|.:.:||               :..|::....|:|.:
plant   186 KTSTVDNAVQDVPKKNKDKDGNDGTTVHSMQNYPWHFHADIVNGNIAKCPQ 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atac1NP_609088.1 SANT 135..183 CDD:238096 15/47 (32%)
LHYNP_171614.1 myb_SHAQKYF 22..72 CDD:130620 19/66 (29%)
PTZ00121 <432..533 CDD:173412
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.