DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atac1 and RL3

DIOPT Version :10

Sequence 1:NP_609088.1 Gene:Atac1 / 33977 FlyBaseID:FBgn0031876 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_195375.4 Gene:RL3 / 829809 AraportID:AT4G36570 Length:58 Species:Arabidopsis thaliana


Alignment Length:64 Identity:16/64 - (25%)
Similarity:35/64 - (54%) Gaps:8/64 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 SNGRSENFNRLWTNEEQSRLEQLLIQYPPEEVEMRRFGKIAKALGNRTAQQVYSRVQKYFQKLH 187
            ||..|.:.:  ||.:|....|:.|..|..:..:  |:..:|:|:|.::|::    |:::::..|
plant     3 SNSMSSSAS--WTRKENKLFERALATYDQDTPD--RWHNVARAVGGKSAEE----VRRHYEPPH 58

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atac1NP_609088.1 SANT 135..183 CDD:238096 12/47 (26%)
RL3NP_195375.4 SANT 12..54 CDD:238096 12/47 (26%)

Return to query results.
Submit another query.