DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atac1 and DNAJC1

DIOPT Version :9

Sequence 1:NP_609088.1 Gene:Atac1 / 33977 FlyBaseID:FBgn0031876 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_071760.2 Gene:DNAJC1 / 64215 HGNCID:20090 Length:554 Species:Homo sapiens


Alignment Length:269 Identity:59/269 - (21%)
Similarity:101/269 - (37%) Gaps:74/269 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 PDLPTLSP------NDEEGGTN--ETPTDASSWTQEANKNRDRSNGRSENFNRLWTNEEQSRLEQ 145
            |:.|..:|      ...:.||:  |.......|.:  |:||.:.....|     ||.|:.|:|.:
Human   283 PEFPVYTPLETTYIQSYDHGTSIEEIEEQMDDWLE--NRNRTQKKQAPE-----WTEEDLSQLTR 340

  Fly   146 LLIQYP---PEEVEMRRFGKIAKALGNRTAQQVYSRVQKYFQKLHDAGMPVPGRIPKHRRPGLSK 207
            .::::|   |     .|:.|||..|| |:...|.::.    ::|.|:....||.:.........:
Human   341 SMVKFPGGTP-----GRWEKIAHELG-RSVTDVTTKA----KQLKDSVTCSPGMVRLSELKSTVQ 395

  Fly   208 PKIKLRKSTFFPAHNISLQ------MPEDDFTFDDLRIPSPASD---------MLLMPASKIEPK 257
            ....::.:|..|...|:.:      ..|::...|.....:.|:|         .||...:|.||:
Human   396 NSRPIKTATTLPDDMITQREDAEGVAAEEEQEGDSGEQETGATDARPRRRKPARLLEATAKPEPE 460

  Fly   258 IES---EYMDADL-------NAESKRK-------------QELCLKLLSAIQDEKREMEDGYEPD 299
            .:|   ...|.|:       :.||.||             |:..|:|  |:|...|...|.::  
Human   461 EKSRAKRQKDFDIAEQNESSDEESLRKERARSAEEPWTQNQQKLLEL--ALQQYPRGSSDRWD-- 521

  Fly   300 LLAAKCAEC 308
                |.|.|
Human   522 ----KIARC 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atac1NP_609088.1 SANT 135..185 CDD:197842 15/52 (29%)
SANT 135..183 CDD:238096 15/50 (30%)
DNAJC1NP_071760.2 DnaJ 65..126 CDD:278647
SANT 329..375 CDD:238096 16/60 (27%)
SANT 495..544 CDD:197842 10/40 (25%)
SANT 496..543 CDD:238096 10/39 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.