DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atac1 and RL4

DIOPT Version :10

Sequence 1:NP_609088.1 Gene:Atac1 / 33977 FlyBaseID:FBgn0031876 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001077912.1 Gene:RL4 / 5007884 AraportID:AT2G18328 Length:77 Species:Arabidopsis thaliana


Alignment Length:67 Identity:19/67 - (28%)
Similarity:33/67 - (49%) Gaps:5/67 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 WTNEEQSRLEQLLIQYPPEEVEMRRFGKIAKALGNRTAQQVYSRVQKYFQKLHDAGMPVPGRIPK 199
            ||..|..:.|..|.::..:..:  |:.|||:|:|.::.::|   .:.|...|.|......||.|:
plant    11 WTAREDKQFEMALAKFDKDTPD--RWQKIARAVGGKSTEEV---KRHYELLLRDVNDIESGRYPQ 70

  Fly   200 HR 201
            .|
plant    71 PR 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atac1NP_609088.1 SANT 135..183 CDD:238096 12/47 (26%)
RL4NP_001077912.1 SANT 15..57 CDD:238096 11/46 (24%)

Return to query results.
Submit another query.