DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atac1 and CG10565

DIOPT Version :10

Sequence 1:NP_609088.1 Gene:Atac1 / 33977 FlyBaseID:FBgn0031876 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_649284.1 Gene:CG10565 / 40332 FlyBaseID:FBgn0037051 Length:646 Species:Drosophila melanogaster


Alignment Length:129 Identity:34/129 - (26%)
Similarity:52/129 - (40%) Gaps:26/129 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 EATQNIYLEN-PQHMLDKLRNNEPLIADNYITTTVLPDLPTLSPNDEEGGTNETPTDASSWTQEA 117
            |.|.....|| .|:.:|...||:....:.   |...|..||.:|         .|..|:      
  Fly   527 EETAQASKENLKQNGVDHKANNQSTKQNG---TAPAPANPTAAP---------APVPAT------ 573

  Fly   118 NKNRDRSNGRSENFNRLWTNEEQSRLEQLLIQYPPEEVEMRRFGKIAKALGNRTAQQVYSRVQK 181
              |.....|.:   ::.||.|||:.|||.:..||....:  |:..||..:.||:.:....||::
  Fly   574 --NGSTGGGAA---SKTWTKEEQALLEQAIKTYPTTTPD--RWDCIAACIPNRSKKDCLRRVKE 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atac1NP_609088.1 SANT 135..183 CDD:238096 17/47 (36%)
CG10565NP_649284.1 ZUO1 56..354 CDD:227594
RAC_head 328..407 CDD:435537
SANT 585..632 CDD:238096 17/48 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.