DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atac1 and Dnajc2

DIOPT Version :9

Sequence 1:NP_609088.1 Gene:Atac1 / 33977 FlyBaseID:FBgn0031876 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_033610.1 Gene:Dnajc2 / 22791 MGIID:99470 Length:621 Species:Mus musculus


Alignment Length:278 Identity:60/278 - (21%)
Similarity:110/278 - (39%) Gaps:60/278 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 QAQRIRVHQQIEELEATQNIYLENPQHMLDKLRNNEPLIADNYITTTVLPDLPTLSPNDEEGGTN 104
            :|.|:::.:::|:|  ...:.|.:.|.:      ||.|     .::|.......|....||  .|
Mouse   370 EADRVKMMEEVEKL--CDRLELASLQGL------NEIL-----ASSTREVGKAALEKQIEE--VN 419

  Fly   105 E----TPTDASSWTQEANKNRDRSNGRSENFNRLWTNEEQSRLEQLLIQYPPE-----EVEMRRF 160
            |    ...:|.:..::|:||.::|.|.|.:.::.|:.::...|.:.:..:|..     || :..:
Mouse   420 EQMRREKEEADARMRQASKNAEKSTGGSGSGSKNWSEDDLQLLIKAVNLFPAGTNSRWEV-IANY 483

  Fly   161 GKIAKALG-NRTAQQVYSRVQKYFQKLHDAGMPVPGRIPKHRRPGLSKPKI-KLRKSTFFPAHNI 223
            ..|..:.| .|||:.|.|:. |..|||           ..|::..::|... |.:|.     |.:
Mouse   484 MNIHSSSGVKRTAKDVISKA-KSLQKL-----------DPHQKDDINKKAFDKFKKE-----HGV 531

  Fly   224 SLQMPEDDFTFDDLRIPSPASD---------MLLMPASKIEPKIESEYMDADLNAESKRKQELCL 279
            :.|.   |......|...|..|         .||..|.|..|....|..:....|...|.::.|:
Mouse   532 ASQA---DSAAPSERFEGPCIDSTPWTTEEQKLLEQALKTYPVNTPERWEKIAEAVPGRTKKDCM 593

  Fly   280 K----LLSAIQDEKREME 293
            :    |:..::.:|...|
Mouse   594 RRYKELVEMVKAKKAAQE 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atac1NP_609088.1 SANT 135..185 CDD:197842 13/55 (24%)
SANT 135..183 CDD:238096 13/53 (25%)
Dnajc2NP_033610.1 ZUO1 75..368 CDD:227594
DnaJ 88..158 CDD:278647
ZRF1-UBD 160..250
RAC_head 349..420 CDD:293322 13/64 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 422..453 7/30 (23%)
SANT 452..508 CDD:197842 13/57 (23%)
SANT 453..506 CDD:238096 13/54 (24%)
SANT 552..602 CDD:197842 10/49 (20%)
SANT 553..600 CDD:238096 9/46 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.