DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atac1 and F54F2.9

DIOPT Version :9

Sequence 1:NP_609088.1 Gene:Atac1 / 33977 FlyBaseID:FBgn0031876 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_498949.2 Gene:F54F2.9 / 176241 WormBaseID:WBGene00018836 Length:414 Species:Caenorhabditis elegans


Alignment Length:170 Identity:37/170 - (21%)
Similarity:62/170 - (36%) Gaps:44/170 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 QQIE-ELEATQNI--YLENPQHMLDKLRNNEPLIADNYITTTVLPD----LPTLSPNDEEGGTNE 105
            ||:| :.|..|.:  ...|...|..|......::|......|..||    |..||......||  
 Worm   240 QQLEFKFEVAQGMKAVSTNDPEMEKKYAAENEVVAQKQSGATWTPDELASLVRLSTEKYPAGT-- 302

  Fly   106 TPTDASSWTQEA---NKNRD--------RSNGRSENFNRL------------------WTNEEQS 141
                .:.|.|..   |::.:        ....:.|::.:|                  |:..||.
 Worm   303 ----PNRWEQMGRVLNRSAEDVIAMAGKMKQMKQEDYTKLLMTTIQQSVPVEEKSEDDWSQAEQK 363

  Fly   142 RLEQLLIQYPPEEVEMRRFGKIAKALGNRTAQQVYSRVQK 181
            ..|..|.:||....|  |:.:|::.:|::|.:||..|.::
 Worm   364 AFETALQKYPKGTDE--RWERISEEIGSKTKKQVMVRFKQ 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atac1NP_609088.1 SANT 135..185 CDD:197842 15/47 (32%)
SANT 135..183 CDD:238096 15/47 (32%)
F54F2.9NP_498949.2 DnaJ 35..96 CDD:278647
SANT 357..402 CDD:238096 15/47 (32%)
SANT 357..402 CDD:197842 15/47 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.