DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atac1 and Dnajc1

DIOPT Version :9

Sequence 1:NP_609088.1 Gene:Atac1 / 33977 FlyBaseID:FBgn0031876 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_002728560.1 Gene:Dnajc1 / 100360412 RGDID:2322144 Length:565 Species:Rattus norvegicus


Alignment Length:298 Identity:62/298 - (20%)
Similarity:116/298 - (38%) Gaps:82/298 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 EELEATQNIYLENPQHMLDKLRNNEPLIADNYITTTVLPDLPTLSPNDE------EGGTN--ETP 107
            |:.:|...:.||. .|...|.:..:|           .|:.|..:|.:.      :.||:  |..
  Rat   266 EKEDALARVELET-LHKQKKAKVKKP-----------KPEFPVYTPLENTYIQSYDHGTSIEEIE 318

  Fly   108 TDASSWTQEANKNRDRSNGRSENFNRLWTNEEQSRLEQLLIQYP---PEEVEMRRFGKIAKALGN 169
            .....|.:  |:||.:.....|     ||.|:.|:|.:.::::|   |     .|:.|||..|| 
  Rat   319 EQMDDWLE--NRNRTQKKQAPE-----WTEEDLSQLTRSMVKFPGGTP-----GRWEKIAHELG- 370

  Fly   170 RTAQQVYSRVQKYFQKLHDAGMPVPGRIPKHRRPGLSKPKIKLRKSTFFPAHNISLQMPEDDFTF 234
            |:...|.::.    ::|.|:....||      ...||:.|..::.|.  |. .|:..:|:|    
  Rat   371 RSVTDVTTKA----KELKDSVTSSPG------MTRLSELKSNVQNSR--PL-KIATALPDD---- 418

  Fly   235 DDLRIPSPASDMLLMPASKIEPKIESEYMDADLNAES--------KRKQELCLKLLSAIQDEKR- 290
                |.:...|    .|..||.: |.|...|:.:.|:        :||.....::::.::.|:: 
  Rat   419 ----IITQRED----SAGAIEEE-EEEQETAEGDQETVTSEARPRRRKSAKVAEVVTRVEPEEKL 474

  Fly   291 -----------EMEDGYEPDLLAAKCAECEEASVTRTQ 317
                       |..|..:.:....:.:...|.:.|::|
  Rat   475 RGKRQKDFDISEQNDSSDEERPRKERSRAAEDAWTQSQ 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atac1NP_609088.1 SANT 135..185 CDD:197842 15/52 (29%)
SANT 135..183 CDD:238096 15/50 (30%)
Dnajc1XP_002728560.1 DnaJ 72..133 CDD:278647
SANT 338..384 CDD:238096 16/60 (27%)
SANT 506..555 CDD:197842 2/7 (29%)
SANT 507..554 CDD:238096 2/6 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.