DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13775 and si:dkey-5n7.2

DIOPT Version :9

Sequence 1:NP_001285694.1 Gene:CG13775 / 33975 FlyBaseID:FBgn0031874 Length:611 Species:Drosophila melanogaster
Sequence 2:XP_005159364.1 Gene:si:dkey-5n7.2 / 796802 ZFINID:ZDB-GENE-050420-254 Length:166 Species:Danio rerio


Alignment Length:166 Identity:35/166 - (21%)
Similarity:59/166 - (35%) Gaps:58/166 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KKKSNVWQYF-YKTSGTVATCLLCNRNYSRRGRGTTCLRNHLKSKHPPEFLSLSGDIKYLDLVKS 66
            |::.::|..| |......:.|..|....:  |:.||.|:.||::.||.              |.:
Zfish    15 KRRIDIWSNFTYDNKDNKSVCKPCGVKIA--GKNTTNLKRHLQTAHPE--------------VHT 63

  Fly    67 EISIGSPQH-----------PTAQ-------LELNLHETDSDPLDTEDISYSKRC---------- 103
            :|...|..|           .|.|       |..:.::|:|....|::.:.::..          
Zfish    64 KIQKMSDDHGPGGNKASDATSTTQQQAISDFLRSSKYKTESKEQQTKEQAIARWIGWTGLPLTTI 128

  Fly   104 -DEKLALMLLNHSFEFIEGPGFV-------NFIRTL 131
             ||...||:     ..|:|...|       |.|:||
Zfish   129 EDEDFVLMM-----GMIDGRLTVPKKTKISNLIKTL 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13775NP_001285694.1 zf-BED 6..48 CDD:280965 11/42 (26%)
Dimer_Tnp_hAT 525..603 CDD:283379
si:dkey-5n7.2XP_005159364.1 zf-BED 20..59 CDD:280965 11/40 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D223749at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.