DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13775 and B0545.4

DIOPT Version :9

Sequence 1:NP_001285694.1 Gene:CG13775 / 33975 FlyBaseID:FBgn0031874 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001367375.1 Gene:B0545.4 / 182029 WormBaseID:WBGene00015247 Length:117 Species:Caenorhabditis elegans


Alignment Length:79 Identity:20/79 - (25%)
Similarity:33/79 - (41%) Gaps:5/79 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   532 PRIDRNMDPLIWWRSNIKYISLYGIVRKFLSAPAASVVSEGLFRKSTHLYFDMQAGLSPESASKM 596
            || |..::||    |...|..|....|:|:..|..|...|.||..:..:....:..|:.|:...:
 Worm    16 PR-DYWLNPL----SKSSYPRLSQFARRFVICPTGSSEVERLFSTAGTILTKYRKTLTSENFKML 75

  Fly   597 LLMKANFSFSNSEI 610
            |.:..|....|.::
 Worm    76 LTLNKNIRLMNPDM 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13775NP_001285694.1 zf-BED 6..48 CDD:280965
Dimer_Tnp_hAT 525..603 CDD:283379 18/70 (26%)
B0545.4NP_001367375.1 Dimer_Tnp_hAT 2..82 CDD:399013 18/70 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166800
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1121
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D223749at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.