DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13775 and bed-2

DIOPT Version :9

Sequence 1:NP_001285694.1 Gene:CG13775 / 33975 FlyBaseID:FBgn0031874 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001362179.1 Gene:bed-2 / 176576 WormBaseID:WBGene00012943 Length:542 Species:Caenorhabditis elegans


Alignment Length:193 Identity:41/193 - (21%)
Similarity:74/193 - (38%) Gaps:50/193 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KKKSNVWQYFY----KTSGTVATCLLCNRNYSRRGRGTTCLRNHLKSKHP--------PEFLSLS 55
            ||...||.:|.    .|......||.|  ::|...|....||.|||..|.        .|.|:.:
 Worm   183 KKSHPVWDFFKDMKDSTGAGGVICLHC--SWSGDDRSPNNLRTHLKKFHSDDGIFNRFSEKLAKT 245

  Fly    56 GDIKYLDLVKSEISIGSPQHPTAQLELNLHETDSDPLDTEDISYSKRCDEKLALMLLNHSFEFIE 120
            ....|:..|:.  ..||.....:.:::     |..|: .:.:::.::..:..:|...:.| .|..
 Worm   246 PTQPYVKRVRG--GAGSSSSLPSMVKM-----DQKPM-LDSMAFLQQLQQSGSLTEADFS-SFAN 301

  Fly   121 GPGFVNFIRTLQPRYTIQPRS---------YYEKILCEDIQRKMHQHLKQQVDLLDAISLSTS 174
            |.. :||:.:|       |:|         :.:|   |:::.....|       ::|.|.|:|
 Worm   302 GSS-LNFLDSL-------PKSSEVININSGFVKK---EEMEEDTENH-------VEAASSSSS 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13775NP_001285694.1 zf-BED 6..48 CDD:280965 14/45 (31%)
Dimer_Tnp_hAT 525..603 CDD:283379
bed-2NP_001362179.1 zf-BED 187..230 CDD:335142 14/44 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D223749at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.