DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13775 and H25P06.5

DIOPT Version :9

Sequence 1:NP_001285694.1 Gene:CG13775 / 33975 FlyBaseID:FBgn0031874 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_001368100.1 Gene:H25P06.5 / 13182103 WormBaseID:WBGene00219319 Length:140 Species:Caenorhabditis elegans


Alignment Length:142 Identity:32/142 - (22%)
Similarity:57/142 - (40%) Gaps:47/142 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   390 ALRDSLR---TDVHNFVSSVT----ICSFARKLLEELEMK-FAHITSDINFLMATYLDPRYKQAF 446
            |.||:||   :.::|.:.:::    .||      :||.:| |..|...:    |||..|.:    
 Worm     3 AHRDALRKKLSKLNNLMKALSGTDWGCS------KELLLKTFNAIVKPV----ATYASPAW---- 53

  Fly   447 FTEREEQLVANEVLLQLAGVPEDCNGQPPLKIIKVSSTSSQKNESKIDSILDSILTTGTTNTQQP 511
                 .|||::          ...|        |:.:|.| .|:.|| .::.::.....:|..:|
 Worm    54 -----AQLVSD----------SSWN--------KIETTCS-TNQDKI-GLISAVEKNWGSNPDKP 93

  Fly   512 NTSMGSQSQIKN 523
            |.....:|.|.:
 Worm    94 NQKTLKRSTISD 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13775NP_001285694.1 zf-BED 6..48 CDD:280965
Dimer_Tnp_hAT 525..603 CDD:283379
H25P06.5NP_001368100.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1121
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.