DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13775 and LOC108183756

DIOPT Version :9

Sequence 1:NP_001285694.1 Gene:CG13775 / 33975 FlyBaseID:FBgn0031874 Length:611 Species:Drosophila melanogaster
Sequence 2:XP_021331252.1 Gene:LOC108183756 / 108183756 -ID:- Length:228 Species:Danio rerio


Alignment Length:306 Identity:59/306 - (19%)
Similarity:105/306 - (34%) Gaps:111/306 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 VFRMKDALSLYCEEYSLVQIYPDEWIEIDLCSKVMQPCEETIKI----------WSNP------- 377
            ::|:..|..::..||               |: ||:|..:.:.|          |..|       
Zfish     2 LYRLSPAEIVFLTEY---------------CT-VMKPVVKALNILQAENNTHMGWLLPVIFQLQI 50

  Fly   378 -----STTTSSVIPLVAALRDSLRTDVHNFVSSVTICSFARKLLEELEMKFAHITSDINFLMATY 437
                 .|::...:||:.|::|.::.           |             |..:..|..|:....
Zfish    51 NLCRLETSSKMCLPLIRAVQDGIQK-----------C-------------FGGMIQDPEFIAPAI 91

  Fly   438 LDPRYKQAFFTEREEQLVANEVLL-----QLAGVPEDCNGQPPLKIIKVSSTSSQKNESKIDSIL 497
            |.|::|.. :||:.:.:.|..|.:     |:|.|..:.:||               :.|..|...
Zfish    92 LLPKFKNT-WTEKTDVIEAGLVYIRKHLDQMAEVAVEQDGQ---------------HSSDEDDFF 140

  Fly   498 DSI---LTTGTTNTQQPNTSMGSQSQIKNLLYLYNSEPRIDRNMDPLIWWRSNIKYISLYGIVRK 559
            .|:   .:.||....:               ||:....::|     |:....:||.:||     |
Zfish   141 SSMKFRRSQGTGELDE---------------YLFCVSDKMD-----LLKSFPHIKKLSL-----K 180

  Fly   560 FLSAPAASVVSEGLFRKSTHLYFDMQAGLSPESASKMLLMKANFSF 605
            ...|..||...|.||..:..|:...:|.::..:....||:|.|..|
Zfish   181 LNIALPASAACERLFSCAGLLFNAKRARMNSSNFENQLLLKLNRKF 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13775NP_001285694.1 zf-BED 6..48 CDD:280965
Dimer_Tnp_hAT 525..603 CDD:283379 20/77 (26%)
LOC108183756XP_021331252.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D223749at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.