DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13775 and LOC108180722

DIOPT Version :9

Sequence 1:NP_001285694.1 Gene:CG13775 / 33975 FlyBaseID:FBgn0031874 Length:611 Species:Drosophila melanogaster
Sequence 2:XP_017208372.1 Gene:LOC108180722 / 108180722 -ID:- Length:412 Species:Danio rerio


Alignment Length:436 Identity:86/436 - (19%)
Similarity:156/436 - (35%) Gaps:106/436 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KKSNVW-QYFYKTSGTVATCLLCNRNYSRRGRGTTCLRNHLKSKHPPEFLSLSGDIKYLDLVKSE 67
            ::.::| ...|......:.|..|....:  |:.||.|:.||::.||.              :.::
Zfish    10 RRIDIWSNSTYDNKDNKSVCKPCGVKIA--GKNTTNLKRHLQTAHPE--------------IHTK 58

  Fly    68 ISIGSPQH-----------PTAQ-------LELNLHETDSDPLDTEDISYSKRCDEKLALMLLNH 114
            |...|..|           .|.|       |..:.::|:|....|::.:.: |...:..|.|.. 
Zfish    59 IQKMSDDHGPGGNKASDATSTTQQQAISDFLRSSKYKTESKEQQTKEQAIA-RWIGRTGLPLTT- 121

  Fly   115 SFEFIEGPGFVNFIRTLQPRYTIQPRSYYEKILCEDIQRKMHQHLKQQVDLLDAISLSTSLW--R 177
                ||...||..:..:..|.|: |:......|.|.......|..::.:.....:|:...||  :
Zfish   122 ----IEDEDFVLMMGMIDGRLTV-PKKTKISNLIETQYEHERQKFRESLAAARKVSIGLDLWTKK 181

  Fly   178 GDKGEGLLSLSCSGISRDFQTHRLMLKCEALNYESTSKL--AC---CIRDLVPSLAIEVPKEKIH 237
            |.....|...:|.......:...::|..:.:.:..|::.  ||   |:::..      :|.|||.
Zfish   182 GLTASFLAISACYFCVEKSKPAHILLALQQVGHPHTAQAIKACVDKCMQEWT------IPVEKIL 240

  Fly   238 CVIRD---EMTAL---------------PGS-------LPD--------------CSVHRLQMCV 263
            .||.|   .|.|.               |||       :.|              |.||.:|:.|
Zfish   241 TVITDNGSNMVAAFKNTTAEETSSEDDSPGSTFESDSEIDDQRYRHVDMELDRTPCVVHTIQLVV 305

  Fly   264 RFALQSNELLQNLSSKCKQIVDHFASSKMANDHLKFIQEIRLTRDPCTLTPYDPC--QWNSAFQM 326
            .. ||....::.:..|.:.:|..|..|.:|...|         .|.|.:...:.|  :|:|.|.|
Zfish   306 HM-LQKETTVKRVLDKARSVVKLFRKSSVATQKL---------LDQCGVIVVNDCPTRWSSTFNM 360

  Fly   327 MSSVFRMKDALSLYCEEYSLVQIYPDEWIEIDLCSKVMQPCEETIK 372
            ::.:.::|||:.....:.....:...||.::.....::.|..|..|
Zfish   361 ITRLLKVKDAVCQISNDMGWDSLLTSEWQKLSSLHDLLLPFAEHTK 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13775NP_001285694.1 zf-BED 6..48 CDD:280965 10/42 (24%)
Dimer_Tnp_hAT 525..603 CDD:283379
LOC108180722XP_017208372.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D223749at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.