powered by:
Protein Alignment CG13775 and si:dkeyp-106c3.2
DIOPT Version :9
Sequence 1: | NP_001285694.1 |
Gene: | CG13775 / 33975 |
FlyBaseID: | FBgn0031874 |
Length: | 611 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001093542.1 |
Gene: | si:dkeyp-106c3.2 / 100001550 |
ZFINID: | ZDB-GENE-070705-527 |
Length: | 116 |
Species: | Danio rerio |
Alignment Length: | 47 |
Identity: | 14/47 - (29%) |
Similarity: | 24/47 - (51%) |
Gaps: | 3/47 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KKKSNVWQYF-YKTSGTVATCLLCNRNYSRRGRGTTCLRNHLKSKHP 48
|::.::|..| |......:.|..|....: |:.||.|:.||::.||
Zfish 15 KRRIDIWSNFTYDNKDNKSVCKPCGVKIA--GKNTTNLKRHLQTAHP 59
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG13775 | NP_001285694.1 |
zf-BED |
6..48 |
CDD:280965 |
11/42 (26%) |
Dimer_Tnp_hAT |
525..603 |
CDD:283379 |
|
si:dkeyp-106c3.2 | NP_001093542.1 |
zf-BED |
20..59 |
CDD:295438 |
11/40 (28%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D223749at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.