DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gas41 and TAF14

DIOPT Version :9

Sequence 1:NP_609086.1 Gene:Gas41 / 33973 FlyBaseID:FBgn0031873 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_015196.1 Gene:TAF14 / 855974 SGDID:S000006050 Length:244 Species:Saccharomyces cerevisiae


Alignment Length:190 Identity:54/190 - (28%)
Similarity:75/190 - (39%) Gaps:48/190 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EDGHTHQWKVYLKPYFNEDMSI---YVKKVHFKLHESYANPNRIVVKPPYEITETGWGEFEVIIK 97
            |:....||.:.:....:|...|   ...||.:.||.::|||||....||:.|.|.|||.|.:.|.
Yeast    25 ENFPVRQWSIEIVLLDDEGKEIPATIFDKVIYHLHPTFANPNRTFTDPPFRIEEQGWGGFPLDIS 89

  Fly    98 IYFNDQS-ERPVTCYHILKLFQSPVVDGELSSSTTMDTKKGLVSESYE-EIVFQEPTQILQHYLL 160
            ::..::: ||.:.  |.|...|                      |||| |.|.|.|   |...||
Yeast    90 VFLLEKAGERKIP--HDLNFLQ----------------------ESYEVEHVIQIP---LNKPLL 127

  Fly   161 LSEQSANGL---LTHDTDFEEKKTKTLDNIVNVKQK---------VKGEIVTLKDKLKLA 208
            ..|.:.:|.   .|.:|....|:..|.:.....|.|         |||.:    |..|||
Yeast   128 TEELAKSGSTEETTANTGTIGKRRTTTNTTAEPKAKRAKTGSASTVKGSV----DLEKLA 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gas41NP_609086.1 YEATS 40..119 CDD:281374 26/82 (32%)
TAF14NP_015196.1 TFG3 2..242 CDD:227366 54/190 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344818
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S932
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23195
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.