DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gas41 and YAF9

DIOPT Version :9

Sequence 1:NP_609086.1 Gene:Gas41 / 33973 FlyBaseID:FBgn0031873 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_014292.3 Gene:YAF9 / 855616 SGDID:S000005051 Length:226 Species:Saccharomyces cerevisiae


Alignment Length:219 Identity:79/219 - (36%)
Similarity:133/219 - (60%) Gaps:18/219 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RLKGVTIVKPIVYGNIARSFGKKREEDG---HTHQWKVYLKPYFNEDMSIYVKKVHFKLHESYAN 72
            |:|.:::.:||:|||.|:..|..:..:.   |||.|.::::...|||:|.::|||.||||::|.|
Yeast     8 RIKTLSVSRPIIYGNTAKKMGSVKPPNAPAEHTHLWTIFVRGPQNEDISYFIKKVVFKLHDTYPN 72

  Fly    73 PNRIVVKPPYEITETGWGEFEVIIKIYF-NDQSERPVTCYHILKL--FQSPVV---DGELSSSTT 131
            |.|.:..||:|:||||||||::.||:|| .:.:|:.:..||.|:|  :.:||.   :|...::|.
Yeast    73 PVRSIEAPPFELTETGWGEFDINIKVYFVEEANEKVLNFYHRLRLHPYANPVPNSDNGNEQNTTD 137

  Fly   132 MDTKKGLVSESY-EEIVFQEPTQILQHYLLLSEQSANGLLTHDTD----FEEKKTKTLDNIVNVK 191
            .::|...||..| :||||.||.:  :.:.:|..:..|.|.::.||    .::.:.:.:|.|....
Yeast   138 HNSKDAEVSSVYFDEIVFNEPNE--EFFKILMSRPGNLLPSNKTDDCVYSKQLEQEEIDRIEIGI 200

  Fly   192 QKVKGEIVTLKDKLK--LARETIS 213
            :||..||..||.||:  :.:|.|:
Yeast   201 EKVDKEIDELKQKLENLVKQEAIN 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gas41NP_609086.1 YEATS 40..119 CDD:281374 38/81 (47%)
YAF9NP_014292.3 TFG3 1..226 CDD:227366 79/219 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I1785
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4760
Inparanoid 1 1.050 131 1.000 Inparanoid score I1239
Isobase 1 0.950 - 0 Normalized mean entropy S932
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003954
OrthoInspector 1 1.000 - - oto100322
orthoMCL 1 0.900 - - OOG6_102192
Panther 1 1.100 - - LDO PTHR23195
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R29
SonicParanoid 1 1.000 - - X2721
TreeFam 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.