DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gas41 and GAS41

DIOPT Version :9

Sequence 1:NP_609086.1 Gene:Gas41 / 33973 FlyBaseID:FBgn0031873 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_199373.1 Gene:GAS41 / 834599 AraportID:AT5G45600 Length:268 Species:Arabidopsis thaliana


Alignment Length:226 Identity:77/226 - (34%)
Similarity:127/226 - (56%) Gaps:38/226 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RLKGVTIVKPIVYGNIARSFGKKREEDGHTHQWKVYLKPYFNEDMSIYVKKVHFKLHESYANPNR 75
            :||.:.|..||||||:|...|||..| ..:|:|.||::...|||:|:.||||.|:||.|:.:|.|
plant    38 KLKDIEISVPIVYGNVAFWLGKKASE-YQSHKWAVYVRGATNEDISVVVKKVVFQLHSSFNSPTR 101

  Fly    76 IVVKPPYEITETGWGEFEVIIKIYF-NDQSERPVTCYHILKLFQSPVVDGELSSSTTMDTKKGLV 139
            ::.:||:|::|:||||||:.:.::| :|..::|::.||.|||:..     :.|...||  ||.:|
plant   102 VIEEPPFEVSESGWGEFEIAMTLHFHSDVCDKPLSLYHHLKLYPE-----DESGPLTM--KKPVV 159

  Fly   140 SESYEEIVFQEPTQ-----ILQHYLLLSEQSANG------LLTHDTDFEEKKTKTLDN------- 186
            .|||:||||.:|::     :..|..|...:..:|      :...||. ::|:..|.|:       
plant   160 VESYDEIVFPDPSESFLARVQNHPALTFPRLPSGYNLPAPMQVEDTG-KKKRGDTKDHSLGQWFM 223

  Fly   187 ----------IVNVKQKVKGEIVTLKDKLKL 207
                      :...:|:|:..|..|:.::.|
plant   224 SFSEADELLQLAAARQQVQAHIAKLRRQISL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gas41NP_609086.1 YEATS 40..119 CDD:281374 36/79 (46%)
GAS41NP_199373.1 YEATS_TFIID14_like 44..175 CDD:341129 62/138 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2633
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 127 1.000 Inparanoid score I1912
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482359at2759
OrthoFinder 1 1.000 - - FOG0003954
OrthoInspector 1 1.000 - - otm3523
orthoMCL 1 0.900 - - OOG6_102192
Panther 1 1.100 - - LDO PTHR23195
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2721
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.