DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gas41 and TAF14

DIOPT Version :9

Sequence 1:NP_609086.1 Gene:Gas41 / 33973 FlyBaseID:FBgn0031873 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001189547.1 Gene:TAF14 / 816312 AraportID:AT2G18000 Length:268 Species:Arabidopsis thaliana


Alignment Length:250 Identity:77/250 - (30%)
Similarity:118/250 - (47%) Gaps:50/250 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DSGG--RLKGVTIVKPIVYGNIARSFGKKREEDGHTHQWKVYLKPYFNEDMSIYVKKVHFKLHES 69
            |..|  |:|.|.:..|||.|:||...|||..| ..||:|.||::...|||:.:.:|:|.|.||.|
plant    28 DENGRRRIKDVEVYVPIVCGSIAFYLGKKATE-YRTHKWTVYVRGATNEDLGVVIKRVIFHLHPS 91

  Fly    70 YANPNRIVVKPPYEITETGWGEFEVIIKIYFN-DQSERPVTCYHILKLFQSPVVDGELSSSTTMD 133
            :.||.|:|..||:.::|.|||||::.|.::|: |..|:.:...|:|||...... |.:..|    
plant    92 FNNPTRVVDAPPFALSECGWGEFKIDITVFFHTDVCEKKLELSHVLKLNPENAY-GPIPKS---- 151

  Fly   134 TKKGLVSESYEEIVFQEP-----TQILQHYLLLSEQSANGL------------LTHDTDFEE--- 178
            .|..:|:|||.|:||.:|     .::..|..:......:||            |....|.:|   
plant   152 IKIPVVAESYNEVVFPDPFESFVARVHNHPAIQISNIPDGLNLPPPGVADTYYLMEKGDTKEHPL 216

  Fly   179 -------KKTKTLDNIVNVKQKVKGEIVTLKDKLKLARETISKFKAELAKVQKQP 226
                   .:.:.|..:...:|||:.:              |:|.|.:|..|..||
plant   217 SPWFLKFSEVEELFKLTAARQKVQAD--------------IAKLKRQLIMVDGQP 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gas41NP_609086.1 YEATS 40..119 CDD:281374 34/79 (43%)
TAF14NP_001189547.1 YEATS_TFIID14_like 40..173 CDD:341129 55/138 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2633
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 127 1.000 Inparanoid score I1912
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482359at2759
OrthoFinder 1 1.000 - - FOG0003954
OrthoInspector 1 1.000 - - otm3523
orthoMCL 1 0.900 - - OOG6_102192
Panther 1 1.100 - - O PTHR23195
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2721
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.