DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gas41 and YEATS4

DIOPT Version :9

Sequence 1:NP_609086.1 Gene:Gas41 / 33973 FlyBaseID:FBgn0031873 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_006521.1 Gene:YEATS4 / 8089 HGNCID:24859 Length:227 Species:Homo sapiens


Alignment Length:224 Identity:134/224 - (59%)
Similarity:166/224 - (74%) Gaps:8/224 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTDFGGDSGGRLKGVTIVKPIVYGNIARSFGKKREEDGHTHQWKVYLKPYFNEDMSIYVKKVHFK 65
            |.:||.|||||:|||||||||||||:||.||||||||||||||.||:|||.|||||.||||:.||
Human     5 MAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFK 69

  Fly    66 LHESYANPNRIVVKPPYEITETGWGEFEVIIKIYFNDQSERPVTCYHILKLFQSPVVDGELSSST 130
            |||||.||.|:|.|||||||||||||||:||||:|.|.:|||||.||:|||||        |.:.
Human    70 LHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQ--------SDTN 126

  Fly   131 TMDTKKGLVSESYEEIVFQEPTQILQHYLLLSEQSANGLLTHDTDFEEKKTKTLDNIVNVKQKVK 195
            .|..||.:|||.|:|::||:||.::|..|..|.|...|...|:|:|.|.:.||.:.:...|:|..
Human   127 AMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTS 191

  Fly   196 GEIVTLKDKLKLARETISKFKAELAKVQK 224
            .||..||::||.:||||:..|.|:.|:::
Human   192 FEIAELKERLKASRETINCLKNEIRKLEE 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gas41NP_609086.1 YEATS 40..119 CDD:281374 61/78 (78%)
YEATS4NP_006521.1 YEATS_GAS41_like 19..155 CDD:341128 99/143 (69%)
Diacetylated histone H3 binding. /evidence=ECO:0000269|PubMed:29900004, ECO:0000269|PubMed:30071723, ECO:0007744|PDB:5VNB, ECO:0007744|PDB:5XTZ 93..97 3/3 (100%)
Interaction with MLLT10. /evidence=ECO:0000269|PubMed:11756182 163..227 22/58 (38%)
Interaction with TACC1. /evidence=ECO:0000269|PubMed:11903063 168..227 21/53 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 141 1.000 Domainoid score I4736
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4760
Inparanoid 1 1.050 275 1.000 Inparanoid score I2981
Isobase 1 0.950 - 0 Normalized mean entropy S932
OMA 1 1.010 - - QHG52998
OrthoDB 1 1.010 - - D1482359at2759
OrthoFinder 1 1.000 - - FOG0003954
OrthoInspector 1 1.000 - - oto91675
orthoMCL 1 0.900 - - OOG6_102192
Panther 1 1.100 - - LDO PTHR23195
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2721
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.830

Return to query results.
Submit another query.