Sequence 1: | NP_609086.1 | Gene: | Gas41 / 33973 | FlyBaseID: | FBgn0031873 | Length: | 227 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_081602.3 | Gene: | Mllt3 / 70122 | MGIID: | 1917372 | Length: | 569 | Species: | Mus musculus |
Alignment Length: | 249 | Identity: | 53/249 - (21%) |
---|---|---|---|
Similarity: | 94/249 - (37%) | Gaps: | 65/249 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 KKREEDGHTHQWKVYLKPYFNEDMSIYVKKVHFKLHESYANPNRIVVKPPYEITETGWGEFEVII 96
Fly 97 KIYFNDQSE-----------------RPVTCYHILKL-FQSPVVD-------------------- 123
Fly 124 ------------------GELSSSTTMDTKKGLVSESYEEIVFQEPTQILQHYLLLSEQSANGLL 170
Fly 171 THDTDFEE------KKTKTLDNIVNVKQKVKGEIVTLKDKLKLARETISKFKAE 218 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Gas41 | NP_609086.1 | YEATS | 40..119 | CDD:281374 | 29/96 (30%) |
Mllt3 | NP_081602.3 | YEATS | 29..109 | CDD:281374 | 24/79 (30%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 137..476 | 19/133 (14%) | |||
Nuclear localization signal. /evidence=ECO:0000255 | 296..301 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5033 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |