DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gas41 and Mllt3

DIOPT Version :9

Sequence 1:NP_609086.1 Gene:Gas41 / 33973 FlyBaseID:FBgn0031873 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_081602.3 Gene:Mllt3 / 70122 MGIID:1917372 Length:569 Species:Mus musculus


Alignment Length:249 Identity:53/249 - (21%)
Similarity:94/249 - (37%) Gaps:65/249 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KKREEDGHTHQWKVYLKPYFNEDMSIYVKKVHFKLHESYANPNRIVVKPPYEITETGWGEFEVII 96
            ||...:|.||.|.|:::...:.::..:|:||.|.||||:..|.|:...|||::.|:|:..|.:.|
Mouse    21 KKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPI 85

  Fly    97 KIYFNDQSE-----------------RPVTCYHILKL-FQSPVVD-------------------- 123
            ::||.::.|                 .||......|| |.:|..|                    
Mouse    86 EVYFKNKEEPKKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGGDPNRSIHTSS 150

  Fly   124 ------------------GELSSSTTMDTKKGLVSESYEEIVFQEPTQILQHYLLLSEQSANGLL 170
                              ...|||::..:.....|.|.....|.:|.::::.:   .|:.:....
Mouse   151 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSFSKPHKLMKEH---KEKPSKDSR 212

  Fly   171 THDTDFEE------KKTKTLDNIVNVKQKVKGEIVTLKDKLKLARETISKFKAE 218
            .|.:.|:|      |.:|.........:.:|.|.:..|...|..:....:.||:
Mouse   213 EHKSAFKEPSRDHNKSSKDSSKKPKENKPLKEEKIVPKMAFKEPKPMSKEPKAD 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gas41NP_609086.1 YEATS 40..119 CDD:281374 29/96 (30%)
Mllt3NP_081602.3 YEATS 29..109 CDD:281374 24/79 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 137..476 19/133 (14%)
Nuclear localization signal. /evidence=ECO:0000255 296..301
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.