DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gas41 and mllt3

DIOPT Version :9

Sequence 1:NP_609086.1 Gene:Gas41 / 33973 FlyBaseID:FBgn0031873 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_012818507.1 Gene:mllt3 / 549668 XenbaseID:XB-GENE-6257679 Length:578 Species:Xenopus tropicalis


Alignment Length:223 Identity:55/223 - (24%)
Similarity:96/223 - (43%) Gaps:43/223 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KKREEDGHTHQWKVYLKPYFNEDMSIYVKKVHFKLHESYANPNRIVVKPPYEITETGWGEFEVII 96
            ||...:|.||.|.|:::...:.::..:|:||.|.||||:..|.|:...|||::.|:|:..|.:.|
 Frog    18 KKPTLEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPI 82

  Fly    97 KIYFNDQSERPVTCYH---ILKLFQSPVVDGELSSSTTMDTKKGLVSESYEEIVFQEPTQILQHY 158
            ::||.::.|.....:.   .|.|...|.|:                ....|::.|..||:..:..
 Frog    83 EVYFKNKEEPKKVRFDYDLFLHLEGHPPVN----------------HLRCEKLTFNNPTEEFRRK 131

  Fly   159 LL-------LSEQS--ANGLLTH-------DTDFEE-KKTKTL------DNIVNVKQKVKGEIVT 200
            ||       .||.|  ::|...|       ...|.: ||:|:.      :.:|::........::
 Frog   132 LLKAGGIMVTSEGSSFSSGTSLHLPSLPCNSLSFSDVKKSKSSHGSKDPNKLVSINNSSNSISLS 196

  Fly   201 LKDK-LKLARETISKFKAELAKVQKQPA 227
            ...| .|..:|..||:..|.....|:|:
 Frog   197 KPHKSSKEHKEKSSKYSKEHRSAFKEPS 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gas41NP_609086.1 YEATS 40..119 CDD:281374 26/81 (32%)
mllt3XP_012818507.1 YEATS_AF-9_like 6..134 CDD:341125 36/131 (27%)
AHD 513..573 CDD:375335
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.