DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gas41 and Yeats2

DIOPT Version :9

Sequence 1:NP_609086.1 Gene:Gas41 / 33973 FlyBaseID:FBgn0031873 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001102527.1 Gene:Yeats2 / 498112 RGDID:1566176 Length:1405 Species:Rattus norvegicus


Alignment Length:243 Identity:72/243 - (29%)
Similarity:98/243 - (40%) Gaps:73/243 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DFGGDSGGRLKGVTIVKPIVYGNIARSF--GKKREEDGHTHQWKVYLK-----PYFNEDMSIYVK 60
            |..||...||   .:.|.||.||:::..  .|:.|.|..||:|.||::     |..|.    :||
  Rat   196 DLAGDETSRL---FVKKTIVVGNVSKYIPPDKREENDQSTHKWMVYVRGSRREPSINH----FVK 253

  Fly    61 KVHFKLHESYANPNRIVV--KPPYEITETGWGEFEVIIKIYFNDQSERPVTCYHILKLFQS---- 119
            ||.|.||.|| .||.:|.  :||:.:|..|||||.|.::::|.|...:.:...|.|||.::    
  Rat   254 KVWFFLHPSY-KPNDLVEVREPPFHLTRRGWGEFPVRVQVHFKDSQNKRIDIIHNLKLDRTYTGL 317

  Fly   120 ------PVVDGEL--------------SSSTTMD-----------TKKGLVSESYEEIV------ 147
                  .|||.||              |.|...|           .|...|:.|.|...      
  Rat   318 QTLGAETVVDVELHRHSLGEDYVYPQSSESDISDAPPPSLTIPAPVKASPVARSPEPASAAPVGE 382

  Fly   148 -FQEPTQILQHYLLLSEQSANGLLTHDTDFEEKKTKTLDNIVNVKQKV 194
             |.:.|:..:|..|.|..|:         .|...||     |...|||
  Rat   383 GFPDSTEAERHSTLYSLPSS---------LERTPTK-----VTAAQKV 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gas41NP_609086.1 YEATS 40..119 CDD:281374 34/85 (40%)
Yeats2NP_001102527.1 YEATS_YEATS2_like 209..332 CDD:341126 47/127 (37%)
PHA03247 <342..653 CDD:223021 20/89 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482359at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.