DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gas41 and ear

DIOPT Version :10

Sequence 1:NP_609086.1 Gene:Gas41 / 33973 FlyBaseID:FBgn0031873 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001262595.1 Gene:ear / 44451 FlyBaseID:FBgn0026441 Length:945 Species:Drosophila melanogaster


Alignment Length:208 Identity:48/208 - (23%)
Similarity:86/208 - (41%) Gaps:53/208 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GNIARSFGKKR-EEDGHTHQWKVYLKPYFNEDMSIYVKKVHFKLHESYANPNRIVVKPPYEITET 87
            |:.::...||. .....||.|::|::.....|:|.:|:||.|.||||:..|.|:|.:|||.|.|:
  Fly    10 GHTSKLRSKKTPHPQAFTHDWEIYVQGVNKADISAFVEKVVFVLHESFPKPKRVVKEPPYAIQES 74

  Fly    88 GWGEFEVIIKIYF--NDQSERPVTCYHILKLFQSPVVDGELSSSTTMDTKKGLVSESYEEI---V 147
            |:..|.:.::|||  .|:.:|.|..|.::.....|                   .:.:.|:   :
  Fly    75 GYAGFLLPVEIYFRNRDEPKRIVYQYDLVLQSTGP-------------------PQHHVEVKTHI 120

  Fly   148 FQEPTQILQHYLL--------------------LSEQSANGLLTHDTDFEEKKTKTLDNIVNV-- 190
            |:.|::..:..|:                    ||....:|...|..:....|.|.:...:::  
  Fly   121 FEAPSEEFRTKLMRGGGVPVFGANIGAGSLARTLSPSVGSGETAHSNEMSGVKAKGVPGTISMNS 185

  Fly   191 ------KQKVKGE 197
                  |.|.:.|
  Fly   186 DLNTGKKHKSRSE 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gas41NP_609086.1 YEATS_GAS41_like 15..159 CDD:341128 38/140 (27%)
earNP_001262595.1 YEATS_AF-9_like 5..134 CDD:341125 39/142 (27%)
AHD 867..927 CDD:436050
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.