Sequence 1: | NP_609086.1 | Gene: | Gas41 / 33973 | FlyBaseID: | FBgn0031873 | Length: | 227 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_004520.2 | Gene: | MLLT3 / 4300 | HGNCID: | 7136 | Length: | 568 | Species: | Homo sapiens |
Alignment Length: | 254 | Identity: | 57/254 - (22%) |
---|---|---|---|
Similarity: | 98/254 - (38%) | Gaps: | 70/254 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 KKREEDGHTHQWKVYLKPYFNEDMSIYVKKVHFKLHESYANPNRIVVKPPYEITETGWGEFEVII 96
Fly 97 KIYFNDQSE-----------------RPVTCYHILKL-FQSPVVD-------------------- 123
Fly 124 ------------------GELSSSTTMDTKKGLVSESYEEIVFQEPTQILQHYLLLSEQSANGLL 170
Fly 171 THDTDFEEKKTKTLDNIVNVKQKVKGEIVTLKDKLKLARETI---SKFKAELAKVQKQP 226 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Gas41 | NP_609086.1 | YEATS | 40..119 | CDD:281374 | 29/96 (30%) |
MLLT3 | NP_004520.2 | YEATS_AF-9_like | 9..137 | CDD:341125 | 34/115 (30%) |
Inhibitor XL-07i binding. /evidence=ECO:0000269|PubMed:30374167, ECO:0007744|PDB:5YYF | 56..58 | 1/1 (100%) | |||
Histone H3K9cr binding. /evidence=ECO:0000269|PubMed:27105114, ECO:0000269|PubMed:30385749, ECO:0007744|PDB:5HJB, ECO:0007744|PDB:5HJD, ECO:0007744|PDB:6MIL, ECO:0007744|PDB:6MIM | 78..80 | 0/1 (0%) | |||
Inhibitor XL-07i binding. /evidence=ECO:0000269|PubMed:30374167, ECO:0007744|PDB:5YYF | 106..109 | 0/2 (0%) | |||
Histone H3K9cr binding. /evidence=ECO:0000269|PubMed:27105114, ECO:0000269|PubMed:30385749, ECO:0007744|PDB:5HJB, ECO:0007744|PDB:5HJD, ECO:0007744|PDB:6MIL, ECO:0007744|PDB:6MIM | 106..108 | 0/1 (0%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 137..475 | 23/138 (17%) | |||
Nuclear localization signal. /evidence=ECO:0000255 | 295..300 | ||||
AHD | 503..563 | CDD:375335 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5033 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |