DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gas41 and MLLT1

DIOPT Version :9

Sequence 1:NP_609086.1 Gene:Gas41 / 33973 FlyBaseID:FBgn0031873 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_011526323.1 Gene:MLLT1 / 4298 HGNCID:7134 Length:600 Species:Homo sapiens


Alignment Length:223 Identity:53/223 - (23%)
Similarity:96/223 - (43%) Gaps:46/223 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KKREEDGHTHQWKVYLKPYFNEDMSIYVKKVHFKLHESYANPNRIVVKPPYEITETGWGEFEVII 96
            ||...:|.||.|.|:::.....|:..:|:||.|.||:|:..|.|:..:|||::.|:|:..|.:.|
Human    62 KKPTTEGFTHDWMVFVRGPEQCDIQHFVEKVVFWLHDSFPKPRRVCKEPPYKVEESGYAGFIMPI 126

  Fly    97 KIYFNDQSERPVTCYH---ILKLFQSPVVDGELSSSTTMDTKKGLVSESYEEIVFQEPTQILQHY 158
            :::|.::.|....|:.   .|.|..:|.|:                ....|::.|..||...::.
Human   127 EVHFKNKEEPRKVCFTYDLFLNLEGNPPVN----------------HLRCEKLTFNNPTTEFRYK 175

  Fly   159 LL------LSEQSANGLLTHDTDF------------EEKKTK----TLDNIVNVKQKVKGEIVTL 201
            ||      :..:.|:.:.....|:            :.||||    :.|......:..|...||.
Human   176 LLRAGGVMVMPEGADTVSRPSPDYPMLPTIPLSAFSDPKKTKPSHGSKDANKESSKTSKPHKVTK 240

  Fly   202 KDKLKLARETISK-----FKAELAKVQK 224
            :.:.:..:::.||     .:.|.||..|
Human   241 EHRERPRKDSESKSSSKELEREQAKSSK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gas41NP_609086.1 YEATS 40..119 CDD:281374 26/81 (32%)
MLLT1XP_011526323.1 YEATS 70..150 CDD:281374 25/79 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.