DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gas41 and yaf9

DIOPT Version :9

Sequence 1:NP_609086.1 Gene:Gas41 / 33973 FlyBaseID:FBgn0031873 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_593730.1 Gene:yaf9 / 2542278 PomBaseID:SPAC17G8.07 Length:217 Species:Schizosaccharomyces pombe


Alignment Length:231 Identity:79/231 - (34%)
Similarity:122/231 - (52%) Gaps:42/231 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RLKGVTIVKPIVYGNIARSFGKKREEDG---HTHQWKVYLKPYFNEDMSIYVKKVHFKLHESYAN 72
            |:....|.:||:.||.|:...|:.:|..   |||.|:::::....||:|.:|:||.||||::|.|
pombe     6 RVSKCQISRPILVGNDAKPLTKEEKEKAPTDHTHTWRIFVEGVDGEDISKWVRKVVFKLHDTYNN 70

  Fly    73 PNRIVVKPPYEITETGWGEFEVIIKIYFNDQS-ERPVTCYHILKLF-QSPVVDGELSSSTTMDTK 135
            |.|.:..||:|:.|||||||:::::|:|..:: |:.:|.||.|||. ..|.::       .|...
pombe    71 PTRTIESPPFEVIETGWGEFDIMVRIFFAPEAHEKALTFYHHLKLHPYGPRME-------EMKAS 128

  Fly   136 KGLV-SESYEEIVFQEPTQILQHYLLLSEQ---SANGLLTH---DTDF----EEKKTKTLDNIVN 189
            .||| |..||||||.||.:..  |.|||:.   ..:||...   |..|    |:.:...||..: 
pombe   129 GGLVESVQYEEIVFNEPFEYT--YKLLSQNPIGDGHGLAVESEPDHPFSQQLEQDEADKLDFAI- 190

  Fly   190 VKQKVKGEIVTLKDKLKLARETISKFKAELAKVQKQ 225
              |:||              :||..:|.::..:|.|
pombe   191 --QEVK--------------KTIEMYKQQVQSLQGQ 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gas41NP_609086.1 YEATS 40..119 CDD:281374 36/80 (45%)
yaf9NP_593730.1 TFG3 1..217 CDD:227366 79/231 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2116
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4760
Inparanoid 1 1.050 113 1.000 Inparanoid score I1560
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003954
OrthoInspector 1 1.000 - - oto102090
orthoMCL 1 0.900 - - OOG6_102192
Panther 1 1.100 - - LDO PTHR23195
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R29
SonicParanoid 1 1.000 - - X2721
TreeFam 00.000 Not matched by this tool.
1211.890

Return to query results.
Submit another query.